ACTR3,ARP3 View larger

Anti-ACTR3 Antibody 100ul

AN-HPA051683-100ul

New product

Anti-ACTR3

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 100ul
Gene Name ACTR3
Gene Description ARP3 actin-related protein 3 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
Immunogen KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61158
HTS Code 3002150000
Gene ID 10096
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human ACTR3, Gene description: ARP3 actin-related protein 3 homolog (yeast), Alternative Gene Names: ARP3, Validated applications: IHC, WB, Uniprot ID: P61158, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image