BCL2L13,BCL-RAMBO View larger

Anti-BCL2L13 Antibody 25ul

AN-HPA050377-25ul

New product

Anti-BCL2L13

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 25ul
Gene Name BCL2L13
Gene Description BCL2-like 13 (apoptosis facilitator)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSLDKEISEAFTSTGFDRHTS
Immunogen MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSLDKEISEAFTSTGFDRHTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCL-RAMBO, MIL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXK5
HTS Code 3002150000
Gene ID 23786
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human BCL2L13, Gene description: BCL2-like 13 (apoptosis facilitator), Alternative Gene Names: BCL-RAMBO, MIL1, Validated applications: ICC, Uniprot ID: Q9BXK5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image