ZFP69B,FLJ34293 View larger

Anti-ZFP69B Antibody 100ul

AN-HPA044289-100ul

New product

Anti-ZFP69B

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name ZFP69B
Gene Description ZFP69 zinc finger protein B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYT
Immunogen KTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ34293, ZKSCAN23B, ZNF643, ZSCAN54B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJL9
HTS Code 3002150000
Gene ID 65243
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human ZFP69B, Gene description: ZFP69 zinc finger protein B, Alternative Gene Names: FLJ34293, ZKSCAN23B, ZNF643, ZSCAN54B, Validated applications: ICC, IHC, Uniprot ID: Q9UJL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image