RPRD1A,FLJ10656 View larger

Anti-RPRD1A Antibody 100ul

AN-HPA040602-100ul

New product

Anti-RPRD1A

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 100ul
Gene Name RPRD1A
Gene Description regulation of nuclear pre-mRNA domain containing 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
Immunogen VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10656, HsT3101, P15RS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96P16
HTS Code 3002150000
Gene ID 55197
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human RPRD1A, Gene description: regulation of nuclear pre-mRNA domain containing 1A, Alternative Gene Names: FLJ10656, HsT3101, P15RS, Validated applications: ICC, IHC, WB, Uniprot ID: Q96P16, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image