View larger
Anti-KLC2 Antibody 100ul
AN-HPA040434-100ul
New product
Anti-KLC2
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100ul |
| Gene Name | KLC2 |
| Gene Description | kinesin light chain 2 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB, ICC, IHC |
| Sequence | TLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNG |
| Immunogen | TLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNG |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | FLJ12387 |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q9H0B6 |
| HTS Code | 3002150000 |
| Gene ID | 64837 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | WB, IHC, ICC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human KLC2, Gene description: kinesin light chain 2, Alternative Gene Names: FLJ12387, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H0B6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF