PAFAH1B3 View larger

Anti-PAFAH1B3 Antibody 25ul

AN-HPA035639-25ul

New product

Anti-PAFAH1B3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name PAFAH1B3
Gene Description platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Immunogen KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15102
HTS Code 3002150000
Gene ID 5050
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human PAFAH1B3, Gene description: platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa), Validated applications: ICC, IHC, WB, Uniprot ID: Q15102, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image