View larger
Anti-SLC1A4 Antibody 25ul
AN-HPA034963-25ul
New product
Anti-SLC1A4
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 25ul |
| Gene Name | SLC1A4 |
| Gene Description | solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA |
| Immunogen | KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | ASCT1, SATT |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | P43007 |
| HTS Code | 3002150000 |
| Gene ID | 6509 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | ICC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human SLC1A4, Gene description: solute carrier family 1 (glutamate/neutral amino acid transporter), member 4, Alternative Gene Names: ASCT1, SATT, Validated applications: ICC, Uniprot ID: P43007, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF