RSPH4A,CILD11 View larger

Anti-RSPH4A Antibody 100ul

AN-HPA031198-100ul

New product

Anti-RSPH4A

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name RSPH4A
Gene Description radial spoke head 4 homolog A (Chlamydomonas)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Immunogen DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TD94
HTS Code 3002150000
Gene ID 345895
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human RSPH4A, Gene description: radial spoke head 4 homolog A (Chlamydomonas), Alternative Gene Names: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B, Validated applications: ICC, IHC, Uniprot ID: Q5TD94, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image