IRF9,ISGF3G View larger

Anti-IRF9 Antibody 25ul

AN-HPA001862-25ul

New product

Anti-IRF9

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 25ul
Gene Name IRF9
Gene Description interferon regulatory factor 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLER
Immunogen EEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ISGF3G
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00978
HTS Code 3002150000
Gene ID 10379
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo IHC, ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human IRF9, Gene description: interferon regulatory factor 9, Alternative Gene Names: ISGF3G, Validated applications: ICC, IHC, Uniprot ID: Q00978, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image