View larger
Anti-MZF1 Antibody 100ul
AN-HPA001757-100ul
New product
Anti-MZF1
Não há pontos de recompensa para este produto.
Data sheet
| Size | 100ul |
| Gene Name | MZF1 |
| Gene Description | myeloid zinc finger 1 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC, ICC |
| Sequence | TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK |
| Immunogen | TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6 |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | P28698 |
| HTS Code | 3002150000 |
| Gene ID | 7593 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | IHC, ICC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human MZF1, Gene description: myeloid zinc finger 1, Alternative Gene Names: MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6, Validated applications: ICC, IHC, Uniprot ID: P28698, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF