View larger
Rabbit polyclonal antibody raised against partial recombinant human DCC.
AB-PAB31060
New product
DCC polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | DCC |
| Gene Alias | CRC18|CRCR1|IGDCC1 |
| Gene Description | deleted in colorectal carcinoma |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IF |
| Immunogen Prot. Seq | GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human DCC. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 1630 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human DCC.