View larger
Rabbit polyclonal antibody raised against partial recombinant human AFP.
AB-PAB30577
New product
AFP polyclonal antibody
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | AFP |
| Gene Alias | FETA|HPAFP |
| Gene Description | alpha-fetoprotein |
| Storage Conditions | Store at 4ºC for short term storage. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IHC-P,IF |
| Immunogen Prot. Seq | FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1 - 4 ug/mL)<br>Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)<br>Western Blot (1:100 - 1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids 51-184 of human AFP. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 174 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human AFP.