AB-PAB29462
New product
This product is no longer in stock
Availability date:
Não há pontos de recompensa para este produto.
Size | 100 uL |
Gene Name | CDC20 |
Gene Alias | CDC20A|MGC102824|bA276H19.3|p55CDC |
Gene Description | cell division cycle 20 homolog (S. cerevisiae) |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IHC-P,IF |
Immunogen Prot. Seq | TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (1:20-1:50)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | Recombinant protein corresponding to human CDC20. |
Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Gene ID | 991 |
Iso type | IgG |