View larger
Rabbit polyclonal antibody raised against recombinant human CDC20.
AB-PAB29462
New product
CDC20 polyclonal antibody
Não há pontos de recompensa para este produto.
Data sheet
| Size | 100 uL |
| Gene Name | CDC20 |
| Gene Alias | CDC20A|MGC102824|bA276H19.3|p55CDC |
| Gene Description | cell division cycle 20 homolog (S. cerevisiae) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P,IF |
| Immunogen Prot. Seq | TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:20-1:50)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human CDC20. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 991 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant human CDC20.