FAM26E polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant FAM26E.

AB-PAB22841

New product

FAM26E polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name FAM26E
Gene Alias C6orf188|MGC45451|dJ493F7.3
Gene Description family with sequence similarity 26, member E
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM26E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254228
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant FAM26E.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant FAM26E.

Rabbit polyclonal antibody raised against recombinant FAM26E.