SYCP2L polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant SYCP2L.

AB-PAB22811

New product

SYCP2L polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name SYCP2L
Gene Alias C6orf177|NO145|dJ62D2.1
Gene Description synaptonemal complex protein 2-like
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYCP2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221711
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant SYCP2L.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant SYCP2L.

Rabbit polyclonal antibody raised against recombinant SYCP2L.