View larger
Rabbit polyclonal antibody raised against recombinant SDCCAG3.
AB-PAB22267
New product
SDCCAG3 polyclonal antibody
Não há pontos de recompensa para este produto.
Data sheet
| Size | 100 uL |
| Gene Name | SDCCAG3 |
| Gene Alias | NY-CO-3 |
| Gene Description | serologically defined colon cancer antigen 3 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P |
| Immunogen Prot. Seq | NEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:200-1:500)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human SDCCAG3. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 10807 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant SDCCAG3.