ZNF677 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ZNF677.

AB-PAB21748

New product

ZNF677 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name ZNF677
Gene Alias MGC48625
Gene Description zinc finger protein 677
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NYRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50- 1:200)<br>Immunofluorescence (0.25-2 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF677.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 342926
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ZNF677.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ZNF677.

Rabbit polyclonal antibody raised against recombinant ZNF677.