View larger
Rabbit polyclonal antibody raised against recombinant TACC1.
AB-PAB21740
New product
TACC1 polyclonal antibody
Não há pontos de recompensa para este produto.
Data sheet
| Size | 100 uL |
| Gene Name | TACC1 |
| Gene Alias | DKFZp686K18126|Ga55|KIAA1103 |
| Gene Description | transforming, acidic coiled-coil containing protein 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P,IF |
| Immunogen Prot. Seq | PTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:200-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human TACC1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 6867 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant TACC1.