ZNF454 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ZNF454.

AB-PAB21712

New product

ZNF454 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name ZNF454
Gene Alias FLJ37444|MGC138481
Gene Description zinc finger protein 454
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPASKKSTVKAEIPEEELDQWTIKERFSSSSHWKCASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGSTMSSSLHSAQSQGFQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF454.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285676
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ZNF454.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ZNF454.

Rabbit polyclonal antibody raised against recombinant ZNF454.