ADSS polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant ADSS.

AB-PAB21689

New product

ADSS polyclonal antibody

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 100 uL
Gene Name ADSS
Gene Alias ADEH|MGC20404
Gene Description adenylosuccinate synthase
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ADSS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 159
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant ADSS.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant ADSS.

Rabbit polyclonal antibody raised against recombinant ADSS.