View larger
Rabbit polyclonal antibody raised against partial recombinant Ivns1abp.
AB-PAB15728
New product
Ivns1abp polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | Ivns1abp |
| Gene Alias | 1190004M08Rik|1700126I16Rik|AA960440|HSPC068|ND1|NS-1|NS1-BP|Nd1-L|Nd1-S|mKIAA0850 |
| Gene Description | influenza virus NS1A binding protein |
| Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Specificity | Specific to recombinant protein GX0474. This antibody detects mIVNS1ABP protein. It also recognizes human IVNS1ABP protein. |
| Application Key | WB |
| Immunogen Prot. Seq | SDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQF |
| Form | Liquid |
| Recomended Dilution | Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Immunogen | Recombinant GST fusion protein corresponding to 172 mouse Ivns1abp. |
| Storage Buffer | In PBS (50% glycerol, 0.02% sodium azide) |
| Gene ID | 117198 |
More info
Rabbit polyclonal antibody raised against partial recombinant Ivns1abp.