ZNF391 purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human ZNF391 protein.

AB-H00346157-B01P

New product

ZNF391 purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name ZNF391
Gene Alias dJ153G14.3
Gene Description zinc finger protein 391
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF391 (AAI56668.1, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 346157

More info

Mouse polyclonal antibody raised against a full-length human ZNF391 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human ZNF391 protein.

Mouse polyclonal antibody raised against a full-length human ZNF391 protein.