View larger
Mouse monoclonal antibody raised against a partial recombinant SH3D19.
AB-H00152503-M01
New product
SH3D19 monoclonal antibody (M01), clone 5C7
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SH3D19 |
| Gene Alias | EBP|EVE1|Kryn|MGC105136|MGC118910|MGC118911|MGC118912|MGC118913|SH3P19 |
| Gene Description | SH3 domain containing 19 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,ELISA,IF |
| Immunogen Prot. Seq | PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SH3D19 (NP_001009555, 94 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 152503 |
| Clone Number | 5C7 |
| Iso type | IgG3 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SH3D19.