View larger
Mouse polyclonal antibody raised against a partial recombinant ERMAP.
AB-H00114625-A01
New product
ERMAP polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | ERMAP |
| Gene Alias | MGC118810|MGC118811|MGC118812|MGC118813|PRO2801|RD|SC |
| Gene Description | erythroblast membrane-associated protein (Scianna blood group) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ERMAP (NP_001017922, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 114625 |
More info
Mouse polyclonal antibody raised against a partial recombinant ERMAP.