View larger
Mouse polyclonal antibody raised against a partial recombinant IL17F.
AB-H00112744-A01
New product
IL17F polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | IL17F |
| Gene Alias | IL-17F|ML-1|ML1 |
| Gene Description | interleukin 17F |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IL17F (NP_443104, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 112744 |
More info
Mouse polyclonal antibody raised against a partial recombinant IL17F.