FOXQ1 monoclonal antibody (M07), clone 4H8 View larger

Mouse monoclonal antibody raised against a partial recombinant FOXQ1.

AB-H00094234-M07

New product

FOXQ1 monoclonal antibody (M07), clone 4H8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FOXQ1
Gene Alias HFH1
Gene Description forkhead box Q1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 94234
Clone Number 4H8
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant FOXQ1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant FOXQ1.

Mouse monoclonal antibody raised against a partial recombinant FOXQ1.