HINT2 monoclonal antibody (M08), clone 1C2 View larger

Mouse monoclonal antibody raised against a partial recombinant HINT2.

AB-H00084681-M08

New product

HINT2 monoclonal antibody (M08), clone 1C2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name HINT2
Gene Alias HIT-17
Gene Description histidine triad nucleotide binding protein 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HINT2 (NP_115982, 60 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84681
Clone Number 1C2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant HINT2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant HINT2.

Mouse monoclonal antibody raised against a partial recombinant HINT2.