View larger
Mouse polyclonal antibody raised against a full-length human PCDHGB6 protein.
AB-H00056100-B01
New product
PCDHGB6 MaxPab mouse polyclonal antibody (B01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | PCDHGB6 |
| Gene Alias | PCDH-GAMMA-B6 |
| Gene Description | protocadherin gamma subfamily B, 6 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MGGSCAQRRRAGPRQVLFPLLLPLFYPTLSEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRRCELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKINSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PCDHGB6 (NP_115271.1, 1 a.a. ~ 820 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 56100 |
More info
Mouse polyclonal antibody raised against a full-length human PCDHGB6 protein.