MCFP purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human MCFP protein.

AB-H00055972-B01P

New product

MCFP purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 50 ug
Gene Name SLC25A40
Gene Alias MCFP
Gene Description solute carrier family 25, member 40
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENETCIPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLRDVPFSAMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCFP (NP_061331, 1 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55972

More info

Mouse polyclonal antibody raised against a full-length human MCFP protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human MCFP protein.

Mouse polyclonal antibody raised against a full-length human MCFP protein.