View larger
Mouse monoclonal antibody raised against a full length recombinant ROPN1.
AB-H00054763-M03
New product
ROPN1 monoclonal antibody (M03), clone 4E11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ROPN1 |
| Gene Alias | DKFZp434B1222|ODF6|RHPNAP1|ROPN1A|ropporin |
| Gene Description | ropporin, rhophilin associated protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IHC-P,S-ELISA,ELISA |
| Immunogen Prot. Seq | MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ROPN1 (AAH15413, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 54763 |
| Clone Number | 4E11 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant ROPN1.