MYOZ2 MaxPab mouse polyclonal antibody (B01) View larger

Mouse polyclonal antibody raised against a full-length human MYOZ2 protein.

AB-H00051778-B01

New product

MYOZ2 MaxPab mouse polyclonal antibody (B01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 uL
Gene Name MYOZ2
Gene Alias C4orf5|CS-1
Gene Description myozenin 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYOZ2 (AAH05195, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51778

More info

Mouse polyclonal antibody raised against a full-length human MYOZ2 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human MYOZ2 protein.

Mouse polyclonal antibody raised against a full-length human MYOZ2 protein.