View larger
Mouse monoclonal antibody raised against a partial recombinant GMNN.
AB-H00051053-M01
New product
GMNN monoclonal antibody (M01), clone 1A8
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | GMNN |
| Gene Alias | Gem|RP3-369A17.3 |
| Gene Description | geminin, DNA replication inhibitor |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 51053 |
| Clone Number | 1A8 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant GMNN.