MAT2B polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a full-length recombinant MAT2B.

AB-H00027430-A01

New product

MAT2B polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name MAT2B
Gene Alias MAT-II|MATIIbeta|MGC12237|Nbla02999|SDR23E1|TGR
Gene Description methionine adenosyltransferase II, beta
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAT2B (AAH05218, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27430

More info

Mouse polyclonal antibody raised against a full-length recombinant MAT2B.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length recombinant MAT2B.

Mouse polyclonal antibody raised against a full-length recombinant MAT2B.