View larger
Mouse polyclonal antibody raised against a full-length human ATP2C1 protein.
AB-H00027032-B01P
New product
ATP2C1 purified MaxPab mouse polyclonal antibody (B01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | ATP2C1 |
| Gene Alias | ATP2C1A|BCPM|HHD|KIAA1347|PMR1|SPCA1|hSPCA1 |
| Gene Description | ATPase, Ca++ transporting, type 2C, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MKVARFQKIPNGENETMIPVLTSKKASELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | ATP2C1 (NP_055197.2, 1 a.a. ~ 919 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 27032 |
More info
Mouse polyclonal antibody raised against a full-length human ATP2C1 protein.