TRUB2 MaxPab mouse polyclonal antibody (B01) View larger

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.

AB-H00026995-B01

New product

TRUB2 MaxPab mouse polyclonal antibody (B01)

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 50 uL
Gene Name TRUB2
Gene Alias CLONE24922|RP11-339B21.1
Gene Description TruB pseudouridine (psi) synthase homolog 2 (E. coli)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRUB2 (NP_056494.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 26995

More info

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.