View larger
Mouse monoclonal antibody raised against a full-length recombinant HAVCR1.
AB-H00026762-M03A
New product
HAVCR1 monoclonal antibody (M03A), clone 2G11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | HAVCR1 |
| Gene Alias | HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1 |
| Gene Description | hepatitis A virus cellular receptor 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHLTTLQGAIRREPTSSPL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HAVCR1 (AAH13325, 1 a.a. ~ 364 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 26762 |
| Clone Number | 2G11 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant HAVCR1.