NAT6 purified MaxPab rabbit polyclonal antibody (D01P) View larger

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.

AB-H00024142-D01P

New product

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name NAT6
Gene Alias FUS-2|FUS2
Gene Description N-acetyltransferase 6 (GCN5-related)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT6 (NP_036323.2, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 24142

More info

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.