View larger
Mouse polyclonal antibody raised against a full-length human EDC4 protein.
AB-H00023644-B01
New product
EDC4 MaxPab mouse polyclonal antibody (B01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | EDC4 |
| Gene Alias | Ge-1|HEDLS|RCD-8 |
| Gene Description | enhancer of mRNA decapping 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCEESSPT |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | EDC4 (NP_055144.3, 1 a.a. ~ 1401 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 23644 |
More info
Mouse polyclonal antibody raised against a full-length human EDC4 protein.