View larger
Mouse polyclonal antibody raised against a partial recombinant PLCB1.
AB-H00023236-A01
New product
PLCB1 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | PLCB1 |
| Gene Alias | FLJ45792|PI-PLC|PLC-154|PLC-I|PLC154 |
| Gene Description | phospholipase C, beta 1 (phosphoinositide-specific) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PLCB1 (NP_056007, 1107 a.a. ~ 1216 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 23236 |
More info
Mouse polyclonal antibody raised against a partial recombinant PLCB1.