CLASP2 monoclonal antibody (M01), clone 3E9 View larger

Mouse monoclonal antibody raised against a full-length recombinant CLASP2.

AB-H00023122-M01

New product

CLASP2 monoclonal antibody (M01), clone 3E9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CLASP2
Gene Alias -
Gene Description cytoplasmic linker associated protein 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLASP2 (AAH29035.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST-pstS1 tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23122
Clone Number 3E9
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant CLASP2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant CLASP2.

Mouse monoclonal antibody raised against a full-length recombinant CLASP2.