SUGT1 monoclonal antibody (M03), clone 6G5 View larger

Mouse monoclonal antibody raised against a partial recombinant SUGT1.

AB-H00010910-M03

New product

SUGT1 monoclonal antibody (M03), clone 6G5

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SUGT1
Gene Alias SGT1
Gene Description SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10910
Clone Number 6G5
Iso type IgG3 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SUGT1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SUGT1.

Mouse monoclonal antibody raised against a partial recombinant SUGT1.