GPNMB monoclonal antibody (M01), clone 1A8 View larger

Mouse monoclonal antibody raised against a partial recombinant GPNMB.

AB-H00010457-M01

New product

GPNMB monoclonal antibody (M01), clone 1A8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GPNMB
Gene Alias HGFIN|NMB
Gene Description glycoprotein (transmembrane) nmb
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPNMB (NP_001005340, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10457
Clone Number 1A8
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GPNMB.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GPNMB.

Mouse monoclonal antibody raised against a partial recombinant GPNMB.