View larger
Mouse polyclonal antibody raised against a partial recombinant CBARA1.
AB-H00010367-A01
New product
CBARA1 polyclonal antibody (A01)
Não há pontos de recompensa para este produto.
Data sheet
| Size | 50 uL |
| Gene Name | CBARA1 |
| Gene Alias | CALC|DKFZp564C246|EFHA3|FLJ12684 |
| Gene Description | calcium binding atopy-related autoantigen 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | DTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CBARA1 (NP_006068, 380 a.a. ~ 478 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 10367 |
More info
Mouse polyclonal antibody raised against a partial recombinant CBARA1.