ABCC4 monoclonal antibody (M03), clone 1B2 View larger

Mouse monoclonal antibody raised against a partial recombinant ABCC4.

AB-H00010257-M03

New product

ABCC4 monoclonal antibody (M03), clone 1B2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ABCC4
Gene Alias EST170205|MOAT-B|MOATB|MRP4
Gene Description ATP-binding cassette, sub-family C (CFTR/MRP), member 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCC4 (AAH41560, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10257
Clone Number 1B2
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ABCC4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ABCC4.

Mouse monoclonal antibody raised against a partial recombinant ABCC4.