View larger
Mouse monoclonal antibody raised against a partial recombinant SGK2.
AB-H00010110-M04
New product
SGK2 monoclonal antibody (M04), clone 4B12
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | SGK2 |
| Gene Alias | H-SGK2|dJ138B7.2 |
| Gene Description | serum/glucocorticoid regulated kinase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10110 |
| Clone Number | 4B12 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SGK2.