View larger
Mouse polyclonal antibody raised against a full-length human PDCD6IP protein.
AB-H00010015-B02
New product
PDCD6IP MaxPab mouse polyclonal antibody (B02)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | PDCD6IP |
| Gene Alias | AIP1|Alix|DRIP4|HP95|MGC17003 |
| Gene Description | programmed cell death 6 interacting protein |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQAN |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PDCD6IP (NP_037506, 1 a.a. ~ 868 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 10015 |
More info
Mouse polyclonal antibody raised against a full-length human PDCD6IP protein.