ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.

AB-H00009762-B01P

New product

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name ProSAPiP1
Gene Alias KIAA0552
Gene Description ProSAPiP1 protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLAMGSVGSGVAHAQEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPSHPPKLLATSGKLDQCSEPLVRPSAFKPVVPKNFHSMQNLCPPQTNGTPEGRQGPGGLKGGLDKSRTMTPAGGSGSGLSDSGRNSLTSLPTYSSSYSQHLAPLSASTSHINRIGTAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ProSAPiP1 (NP_055546.1, 1 a.a. ~ 673 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9762

More info

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.