AATK monoclonal antibody (M03A), clone 5B8 View larger

Mouse monoclonal antibody raised against a partial recombinant AATK.

AB-H00009625-M03A

New product

AATK monoclonal antibody (M03A), clone 5B8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 200 uL
Gene Name AATK
Gene Alias AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP
Gene Description apoptosis-associated tyrosine kinase
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9625
Clone Number 5B8
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant AATK.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant AATK.

Mouse monoclonal antibody raised against a partial recombinant AATK.