View larger
Mouse monoclonal antibody raised against a partial recombinant ABCG1.
AB-H00009619-M01
New product
ABCG1 monoclonal antibody (M01), clone 2E11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ABCG1 |
| Gene Alias | ABC8|MGC34313|WHITE1 |
| Gene Description | ATP-binding cassette, sub-family G (WHITE), member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA |
| Immunogen Prot. Seq | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9619 |
| Clone Number | 2E11 |
| Iso type | IgG1 Lambda |
More info
Mouse monoclonal antibody raised against a partial recombinant ABCG1.