View larger
Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
AB-H00009261-M02
New product
MAPKAPK2 monoclonal antibody (M02), clone 2A10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | MAPKAPK2 |
| Gene Alias | MK2 |
| Gene Description | mitogen-activated protein kinase-activated protein kinase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9261 |
| Clone Number | 2A10 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.